A4454
USP10 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4454
- Additional Names:
- MGC2621|UBP10|UBPO|USP10
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFGVDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKIT
- Uniprot:
- Q14694
- Synonyms:
- deubiquitinating enzyme 10;ubiquitin carboxyl-terminal hydrolase 10;ubiquitin specific protease 10;ubiquitin thioesterase 10;ubiquitin thiolesterase 10;ubiquitin-specific-processing protease 10;UBPO
- Extra Details:
- Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubiquitin from ubiquitin-conjugated protein substrates. The protein is found in the nucleus and cytoplasm. It functions as a co-factor of the DNA-bound androgen receptor complex, and is inhibited by a protein in the Ras-GTPase pathway. The human genome contains several pseudogenes similar to this gene. Several transcript variants, some protein-coding and others not protein-coding, have been found for this gene.
- Shipping Conditions:
- Blue Ice