GNB5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4447
Additional Names:: GB5|gbeta5|GNB5|HG2E|IDDCA|LADCI
Application:: ELISA, WB
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLC
Uniprot:: O14775
Synonyms:: G protein, beta subunit 5L;GB5;gbeta5;guanine nucleotide binding protein (G protein), beta 5;guanine nucleotide-binding protein subunit beta-5;guanine nucleotide-binding protein, beta subunit 5L;IDDCA;LADCI;transducin beta chain 5
Extra Details:: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist.