IP3R Rabbit monoclonal antibody

Size

POA

SKU:: A4436
Additional Names:: ACV|CLA4|INSP3R1|IP3R|IP3R1|PPP1R94|SCA15|SCA16|SCA29
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 320kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
ABP:: No Import Docs
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVA
Uniprot:: Q14643
Synonyms:: ACV;CLA4;inositol 1,4,5-triphosphate receptor, type 1;inositol 1,4,5-trisphosphate receptor type 1;INSP3R1;IP3 receptor;IP3 receptor isoform 1;IP3R;IP3R 1;IP3R1;PPP1R94;protein phosphatase 1, regulatory subunit 94;SCA15;SCA16;SCA29;type 1 inositol 1,4,5-trisphosphate receptor;type 1 InsP3 receptor
Extra Details:: This gene encodes an intracellular receptor for inositol 1,4,5-trisphosphate. Upon stimulation by inositol 1,4,5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene.