A4426
EIF3M Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A4426
- Additional Names:
- B5|EIF3M|GA17|hfl-B5|PCID1|TANGO7
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 40kDa/36kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
- Uniprot:
- Q7L2H7
- Synonyms:
- B5;B5 receptor;dendritic cell protein;eukaryotic translation initiation factor 3 subunit M;fetal lung protein B5;GA17;hfl-B5;PCI domain containing 1 (herpesvirus entry mediator);PCI domain-containing protein 1;PCID1;TANGO7;transport and golgi organization 7 homolog
- Extra Details:
- This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome.
- Shipping Conditions:
- Blue Ice





_WB_01.jpg)

