ATP5H Rabbit polyclonal antibody

Size

£152.00

SKU:: A4425
Additional Names:: APT5H|ATP5H|ATPQ
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Uniprot:: O75947
Synonyms:: APT5H;ATP synthase D chain, mitochondrial;ATP synthase subunit d, mitochondrial;ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d;ATP synthase, H+ transporting, mitochondrial F1F0, subunit d;ATP synthase, H+ transporting, mitochondrial Fo complex subunit D;ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d;ATP5H;ATPase subunit d;ATPQ;My032 protein
Extra Details:: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15.

Shipping Conditions:: Blue Ice