A4385
NEDD4 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4385
- Additional Names:
- NEDD4|NEDD4-1|RPF1
- Application:
- ELISA, WB
- Molecular Weight:
- 115kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEE
- Uniprot:
- P46934
- Synonyms:
- cell proliferation-inducing gene 53 protein;E3 ubiquitin-protein ligase NEDD4;HECT-type E3 ubiquitin transferase NEDD4;NEDD4-1;Neural precursor cell expressed developmentally down-regulated protein 4;neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase;receptor-potentiating factor 1;RPF1
- Extra Details:
- This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN.
- Shipping Conditions:
- Blue Ice