A4376
ERp57 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4376
- Additional Names:
- ER60|ERp57|ERp60|ERp61|GRP57|GRP58|HEL-S-269|HEL-S-93n|HsT17083|P58|PI-PLC
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 57kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNG
- Uniprot:
- P30101
- Synonyms:
- 58 kDa glucose-regulated protein;58 kDa microsomal protein;disulfide isomerase ER-60;endoplasmic reticulum P58;endoplasmic reticulum resident protein 57;endoplasmic reticulum resident protein 60;epididymis secretory protein Li 269;epididymis secretory sperm binding protein Li 93n;ER protein 57;ER protein 60;ER60;ERp57;ERp60;ERp61;glucose regulated protein, 58kDa;GRP57;GRP58;HEL-S-269;HEL-S-93n;HsT17083;P58;phospholipase C-alpha;PI-PLC;protein disulfide isomerase-associated 3;protein disulfide-isomerase A3
- Extra Details:
- This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates.
- Shipping Conditions:
- Blue Ice