USH1C Rabbit polyclonal antibody

Size

£152.00

SKU:: A4368
Additional Names:: USH1C|zgc:136806
Application:: ELISA, WB
Molecular Weight:: 73kDa
Species Reactivity:: Fish
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
Synonyms:: AIE-75;antigen NY-CO-38/NY-CO-37;autoimmune enteropathy-related antigen AIE-75;DFNB18;DFNB18A;ha;harmonin;harmonin pseudogene;NY-CO-37;NY-CO-38;PDZ-45;PDZ-73;PDZ-73/NY-CO-38;PDZ73;PDZD7C;renal carcinoma antigen NY-REN-3;ush1cpst;Usher syndrome 1C (autosomal recessive, severe);usher syndrome type-1C protein;zgc:136806
Extra Details:: Predicted to enable actin filament binding activity. Acts upstream of or within neuron development; startle response; and synapse organization. Predicted to be part of stereocilia ankle link complex. Predicted to be active in several cellular components, including cilium; photoreceptor inner segment; and stereocilium tip. Is expressed in brain; hair cell; pleuroperitoneal region; sensory system; and trunk musculature. Used to study Usher syndrome. Human ortholog(s) of this gene implicated in Usher syndrome; Usher syndrome type 1; Usher syndrome type 1C; and autosomal recessive nonsyndromic deafness 18A. Orthologous to human USH1C (USH1 protein network component harmonin).

Shipping Conditions:: Blue Ice