Rad18 Rabbit monoclonal antibody

Size

POA

SKU:: A4339
Additional Names:: Rad18|RNF73
Application:: ELISA, WB
Molecular Weight:: 70 kDa/90 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESP
Uniprot:: Q9NS91
Synonyms:: E3 ubiquitin-protein ligase RAD18;hHR18;hRAD18;postreplication repair protein hRAD18p;postreplication repair protein RAD18;RAD18 homolog;RAD18, S. cerevisiae, homolog;RING finger protein 73;RING-type E3 ubiquitin transferase RAD18;RNF73
Extra Details:: The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.