A4338
eIF4A3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A4338
- Additional Names:
- DDX48|eIF-4A-III|eIF4A-III|eIF4A3|eIF4AIII|Fal1|MUK34|NMP265|NUK34|RCPS
- Application:
- ELISA, WB
- Molecular Weight:
- 47kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP
- Uniprot:
- P38919
- Synonyms:
- ATP-dependent RNA helicase DDX48;ATP-dependent RNA helicase eIF4A-3;DDX48;DEAD (Asp-Glu-Ala-Asp) box polypeptide 48;DEAD box protein 48;eIF-4A-III;eIF4A-III;eIF4AIII;eukaryotic initiation factor 4A-III;eukaryotic initiation factor 4A-like NUK-34;Eukaryotic translation initiation factor 4A isoform 3;Fal1;MUK34;NMP 265;NMP265;nuclear matrix protein 265;NUK34;RCPS
- Extra Details:
- This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family.
- Shipping Conditions:
- Blue Ice

