A4331
PGC1 beta Rabbit monoclonal antibody
Size
POA
- SKU:
- A4331
- Additional Names:
- ERRL1|PERC|PGC-1(beta)|PGC1 beta|PGC1B
- Application:
- ELISA, WB
- Molecular Weight:
- 113kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
- Uniprot:
- Q86YN6
- Synonyms:
- ERRL1;PERC;peroxisome proliferator-activated receptor gamma coactivator 1-beta;peroxisome proliferator-activated receptor gamma, coactivator 1 beta;PGC-1-related estrogen receptor alpha coactivator;PGC-1(beta);PGC1B;PPAR-gamma coactivator 1-beta;PPARgamma coactivator 1 beta;PPARGC-1-beta
- Extra Details:
- The protein encoded by this gene stimulates the activity of several transcription factors and nuclear receptors, including estrogen receptor alpha, nuclear respiratory factor 1, and glucocorticoid receptor. The encoded protein may be involved in fat oxidation, non-oxidative glucose metabolism, and the regulation of energy expenditure. This protein is downregulated in prediabetic and type 2 diabetes mellitus patients. Certain allelic variations in this gene increase the risk of the development of obesity. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice