A4328
ABCG1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A4328
- Additional Names:
- ABC8|ABCG1|WHITE1
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS
- Uniprot:
- P45844
- Synonyms:
- ABC transporter 8;ABC8;ATP-binding cassette sub-family G member 1;ATP-binding cassette transporter 8;ATP-binding cassette transporter member 1 of subfamily G;ATP-binding cassette, sub-family G (WHITE), member 1;homolog of Drosophila white;White protein homolog;white protein homolog (ATP-binding cassette transporter 8);WHITE1
- Extra Details:
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.
- Shipping Conditions:
- Blue Ice