A4296
DDR2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4296
- Additional Names:
- DDR2|MIG20a|NTRKR3|TKT|TYRO10|WRCN
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQQGDE
- Uniprot:
- Q16832
- Synonyms:
- CD167 antigen-like family member B;cell migration-inducing protein 20;discoidin domain receptor 2;discoidin domain receptor family, member 2;discoidin domain-containing receptor 2;discoidin domain-containing receptor tyrosine kinase 2;hydroxyaryl-protein kinase;MIG20a;migration-inducing gene 16 protein;neurotrophic tyrosine kinase receptor related 3;Neurotrophic tyrosine kinase, receptor-related 3;NTRKR3;receptor protein-tyrosine kinase TKT;TKT;TYRO10;tyrosine-protein kinase TYRO10;WRCN
- Extra Details:
- This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia.
- Shipping Conditions:
- Blue Ice