A4282
UBE2L6 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A4282
- Additional Names:
- RIG-B|UBCH8|UBE2L6
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
- Uniprot:
- O14933
- Synonyms:
- E2 ubiquitin-conjugating enzyme L6;retinoic acid induced gene B protein;Retinoic acid-induced gene B protein;RIG-B;UBCH8;ubiquitin carrier protein L6;ubiquitin conjugating enzyme E2L 6;ubiquitin-protein ligase L6;ubiquitin/ISG15-conjugating enzyme E2 L6
- Extra Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice