TRPM8 Rabbit monoclonal antibody

Size

POA

SKU:: A4269
Additional Names:: LTrpC-6|LTRPC6|trp-p8|TRPM8|TRPP8
Application:: ELISA, WB
Molecular Weight:: 110 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FRSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYF
Uniprot:: Q7Z2W7
Synonyms:: Long transient receptor potential channel 6;LTrpC-6;LTRPC6;transient receptor potential cation channel subfamily M member 8;transient receptor potential p8;transient receptor potential subfamily M member 8;trp-p8;TRPM8 cationic channel;TRPP8
Extra Details:: Predicted to enable ligand-gated calcium channel activity. Predicted to be involved in calcium ion transmembrane transport and positive regulation of cold-induced thermogenesis. Predicted to act upstream of or within several processes, including cellular calcium ion homeostasis; response to cold; and thermoception. Located in plasma membrane.