WNK1 Rabbit monoclonal antibody

Size

POA

SKU:: A4223
Additional Names:: HSAN2|HSN2|KDP|p65|PPP1R167|PRKWNK1|PSK|WNK1
Application:: ELISA, WB
Molecular Weight:: 251kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPL
Uniprot:: Q9H4A3
Synonyms:: erythrocyte 65 kDa protein;HSAN2;HSN2;KDP;Kinase deficient protein;p65;PPP1R167;PRKWNK1;prostate-derived sterile 20-like kinase;Protein kinase lysine-deficient 1;protein kinase with no lysine 1;protein phosphatase 1, regulatory subunit 167;PSK;serine/threonine-protein kinase WNK1;serine/threonine-protein kinase WNK1 1;serine/threonine-protein kinase WNK1 2
Extra Details:: This gene encodes a member of the WNK subfamily of serine/threonine protein kinases. The encoded protein may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with pseudohypoaldosteronism type II and hereditary sensory neuropathy type II. Alternatively spliced transcript variants encoding different isoforms have been described but the full-length nature of all of them has yet to be determined.