A4176
ESRRA Rabbit monoclonal antibody
Size
POA
- SKU:
- A4176
- Additional Names:
- ERR1|ERRa|ERRalpha|ESRL1|ESRRA|NR3B1
- Application:
- ELISA, WB
- Molecular Weight:
- 48-50kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACK
- Uniprot:
- P11474
- Synonyms:
- ERR-alpha;ERR1;ERRa;ERRalpha;ESRL1;estrogen receptor-like 1;estrogen-related nuclear receptor alpha;Estrogen-related receptor alpha;NR3B1;nuclear receptor subfamily 3 group B member 1;steroid hormone receptor ERR1
- Extra Details:
- The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1.
- Shipping Conditions:
- Blue Ice