MSMB Rabbit monoclonal antibody

Size

POA

SKU:: A4168
Additional Names:: HPC13|IGBF|MSMB|MSP|MSPB|PN44|PRPS|PSP|PSP-94|PSP57|PSP94
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEK
Uniprot:: P08118
Synonyms:: beta-microseminoprotein;HPC13;IGBF;immunoglobulin binding factor;Immunoglobulin-binding factor;MSP;MSPB;PN44;prostate secreted seminal plasma protein;prostate secretory protein of 94 amino acids;PRPS;PSP;PSP-94;PSP57;PSP94;seminal plasma beta-inhibin
Extra Details:: The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.