TEAD4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4151
Additional Names:: EFTR-2|hRTEF-1B|RTEF1|TCF13L1|TEAD4|TEF-3|TEF3|TEFR-1
Application:: ELISA, WB
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI
Uniprot:: Q15561
Synonyms:: EFTR-2;hRTEF-1B;related transcription enhancer factor 1B;RTEF1;TCF13L1;TEA domain family member 4;TEF-3;TEF3;TEFR-1;transcription factor 13-like 1;transcription factor RTEF-1;transcriptional enhancer factor 1-related;transcriptional enhancer factor 3;transcriptional enhancer factor TEF-3
Extra Details:: This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.