A4147
TrkA Rabbit monoclonal antibody

Size
POA
- SKU:
- A4147
- Additional Names:
- MTC|p140-TrkA|TRK|Trk-A|TRK1|TRKA
- Application:
- ELISA, WB
- Molecular Weight:
- 140 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
- Uniprot:
- P04629
- Synonyms:
- gp140trk;high affinity nerve growth factor receptor;MTC;Neurotrophic tyrosine kinase receptor type 1;neurotrophic tyrosine kinase, receptor, type 1;Oncogene TRK;p140-TrkA;TRK;Trk-A;TRK1;TRK1-transforming tyrosine kinase protein;TRKA;tropomyosin-related kinase A;Tyrosine kinase receptor;tyrosine kinase receptor A
- Extra Details:
- This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.
- Shipping Conditions:
- Blue Ice

