A4135
XRCC1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4135
- Additional Names:
- RCC|SCAR26|XRCC1
- Application:
- ELISA, WB
- Molecular Weight:
- 82kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESR
- Uniprot:
- P18887
- Synonyms:
- DNA repair protein XRCC1;RCC;SCAR26;X-ray repair complementing defective repair in Chinese hamster cells 1;X-ray repair cross-complementing protein 1
- Extra Details:
- The protein encoded by this gene is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. This protein interacts with DNA ligase III, polymerase beta and poly (ADP-ribose) polymerase to participate in the base excision repair pathway. It may play a role in DNA processing during meiogenesis and recombination in germ cells. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
- Shipping Conditions:
- Blue Ice