SLC20A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4117
Additional Names:: Glvr-1|GLVR1|PiT-1|PIT1|SLC20A1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 70-100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN
Uniprot:: Q8WUM9
Synonyms:: gibbon ape leukemia virus receptor 1;Glvr-1;GLVR1;leukemia virus receptor 1 homolog;Phosphate transporter 1;PiT-1;PIT1;sodium-dependent phosphate transporter 1;solute carrier family 20 (phosphate transporter), member 1;Solute carrier family 20 member 1
Extra Details:: The protein encoded by this gene is a sodium-phosphate symporter that absorbs phosphate from interstitial fluid for use in cellular functions such as metabolism, signal transduction, and nucleic acid and lipid synthesis. The encoded protein is also a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus.