TMEFF2 Rabbit monoclonal antibody

Size

POA

SKU:: A4116
Additional Names:: CT120.2|HPP1|TENB2|TMEFF2|TPEF|TR|TR-2
Application:: ELISA, WB
Molecular Weight:: 41kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGHYSSDNTTRASTRLI
Uniprot:: Q9UIK5
Synonyms:: cancer/testis antigen family 120, member 2;CT120.2;HPP1;hyperplastic polyposis protein 1;TENB2;tomoregulin-2;TPEF;TR;TR-2;transmembrane protein TENB2;transmembrane protein with EGF-like and two follistatin-like domains
Extra Details:: This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple soluble forms of this protein have been identified that arise from both an alternative splice variant and ectodomain shedding. Additionally, this gene has been found to be hypermethylated in multiple cancer types. Alternative splicing results in multiple transcript variants.