A4115
Lipoprotein lipase (LPL) Rabbit monoclonal antibody
Size
POA
- SKU:
- A4115
- Additional Names:
- HDLCQ11|LIPD|Lipoprotein lipase (LPL)
- Application:
- ELISA, WB
- Molecular Weight:
- 53kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
- Uniprot:
- P06858
- Synonyms:
- HDLCQ11;LIPD;lipoprotein lipase;phospholipase A1
- Extra Details:
- LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.
- Shipping Conditions:
- Blue Ice