alpha Sarcoglycan (SGCA) Rabbit polyclonal antibody

Size

£152.00

SKU:: A4109
Additional Names:: 50DAG|adhalin|ADL|alpha Sarcoglycan (SGCA)|DAG2|DMDA2|LGMD2D|LGMDR3|SCARMD1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVDA
Uniprot:: Q16586
Synonyms:: 50 kDa dystrophin-associated glycoprotein;50DAG;50kD DAG;adhalin;ADL;alpha-sarcoglycan;alpha-SG;DAG2;DMDA2;dystroglycan-2;LGMD2D;LGMDR3;limb girdle muscular dystrophy 2D;sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein);SCARMD1
Extra Details:: This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice