[KO Validated] S100A6 Rabbit polyclonal antibody

Size

POA

SKU:: A4104
Additional Names:: 2A9|5B10|A6|CABP|CACY|PRA|S10A6
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 10kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Uniprot:: P06703
Synonyms:: 2A9;5B10;CABP;CACY;calcyclin;growth factor-inducible protein 2A9;MLN 4;PRA;prolactin receptor-associated protein;protein S100-A6;S100 calcium-binding protein A6;S10A6
Extra Details:: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.