A4067
TTR Rabbit monoclonal antibody

Size
POA
- SKU:
- A4067
- Additional Names:
- ATTR|CTS|CTS1|HEL111|HsT2651|PALB|TBPA|TTN|TTR
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa/30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE
- Uniprot:
- P02766
- Synonyms:
- ATTR;CTS;CTS1;epididymis luminal protein 111;HEL111;HsT2651;PALB;Prealbumin;prealbumin, amyloidosis type I;TBPA;thyroxine-binding prealbumin;transthyretin;TTN
- Extra Details:
- This gene encodes one of the three prealbumins, which include alpha-1-antitrypsin, transthyretin and orosomucoid. The encoded protein, transthyretin, is a homo-tetrameric carrier protein, which transports thyroid hormones in the plasma and cerebrospinal fluid. It is also involved in the transport of retinol (vitamin A) in the plasma by associating with retinol-binding protein. The protein may also be involved in other intracellular processes including proteolysis, nerve regeneration, autophagy and glucose homeostasis. Mutations in this gene are associated with amyloid deposition, predominantly affecting peripheral nerves or the heart, while a small percentage of the gene mutations are non-amyloidogenic. The mutations are implicated in the etiology of several diseases, including amyloidotic polyneuropathy, euthyroid hyperthyroxinaemia, amyloidotic vitreous opacities, cardiomyopathy, oculoleptomeningeal amyloidosis, meningocerebrovascular amyloidosis and carpal tunnel syndrome.
- Shipping Conditions:
- Blue Ice


