A4064
SMMHC/MYH11 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4064
- Additional Names:
- AAT4|FAA4|SMHC|SMMHC|SMMHC/MYH11|SMMS-1|VSCM2
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 227 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL
- Uniprot:
- P35749
- Synonyms:
- AAT4;epididymis secretory sperm binding protein;FAA4;Myosin heavy chain 11;Myosin heavy chain, smooth muscle isoform;myosin-11;myosin, heavy chain 11, smooth muscle;myosin, heavy polypeptide 11, smooth muscle;SMHC;SMMHC;VSCM2
- Extra Details:
- The protein encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. A chromosomal rearrangement involving this gene is associated with acute myeloid leukemia of the M4Eo subtype. Mutations in this gene are associated with visceral myopathy, megacystis-microcolon-intestinal hypoperistalsis syndrome 2, and familial thoracic aortic aneurysm 4.
- Shipping Conditions:
- Blue Ice