A4050
NDRG1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4050
- Additional Names:
- CAP43|CMT4D|DRG-1|DRG1|GC4|HMSNL|NDR1|NDRG1|NMSL|PROXY1|RIT42|RTP|TARG1|TDD5
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 48kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
- Uniprot:
- Q92597
- Synonyms:
- CAP43;CMT4D;differentiation-related gene 1 protein;DRG-1;DRG1;GC4;HMSNL;N-myc downstream-regulated gene 1 protein;NDR1;nickel-specific induction protein Cap43;NMSL;protein NDRG1;protein regulated by oxygen-1;PROXY1;reducing agents and tunicamycin-responsive protein;RIT42;RTP;TARG1;TDD5
- Extra Details:
- This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice