TRPC1 Rabbit monoclonal antibody

Size

POA

SKU:: A4016
Additional Names:: HTRP-1|TRP1|TRPC1
Application:: ELISA, WB
Molecular Weight:: 130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG
Uniprot:: P48995
Synonyms:: capacitative calcium channel protein Trp1;HTRP-1;short transient receptor potential channel 1;transient receptor potential canonical 1;transient receptor protein 1;TRP-1;TRP1
Extra Details:: The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene.