A4007
NDUFAF1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4007
- Additional Names:
- CGI-65|CGI65|CIA30|MC1DN11|NDUFAF1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTSDKTIGGRSEV
- Uniprot:
- Q9Y375
- Synonyms:
- CGI-65;CGI65;CIA30;complex I intermediate-associated protein 30, mitochondrial;MC1DN11;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 1;NADH dehydrogenase (ubiquinone) complex I, assembly factor 1;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1;NADH-ubiquinone oxidoreductase 1 alpha subcomplex, assembly factor 1
- Extra Details:
- This gene encodes a complex I assembly factor protein. Complex I (NADH-ubiquinone oxidoreductase) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. The encoded protein is required for assembly of complex I, and mutations in this gene are a cause of mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19.
- Shipping Conditions:
- Blue Ice