NDUFB2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3978
Additional Names:: AGGG|CI-AGGG|NDUFB2
Application:: ELISA, WB
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Uniprot:: O95178
Synonyms:: AGGG;CI-AGGG;complex I AGGG subunit;complex I-AGGG;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial;NADH-ubiquinone oxidoreductase AGGG subunit
Extra Details:: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I.