NDUFA5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3976
Additional Names:: B13|CI-13kB|CI-13KD-B|NDUFA5|NUFM|UQOR13
Application:: ELISA, WB
Molecular Weight:: 13kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Uniprot:: Q16718
Synonyms:: B13;CI-13kB;CI-13KD-B;complex I 13kDa subunit B;complex I subunit B13;Complex I-13kD-B;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5;NADH-ubiquinone oxidoreductase 13 kDa-B subunit;NUFM;type I dehydrogenase;ubiquinone reductase;UQOR13
Extra Details:: This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16.