A3976
NDUFA5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3976
- Additional Names:
- B13|CI-13kB|CI-13KD-B|NDUFA5|NUFM|UQOR13
- Application:
- ELISA, WB
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
- Uniprot:
- Q16718
- Synonyms:
- B13;CI-13kB;CI-13KD-B;complex I 13kDa subunit B;complex I subunit B13;Complex I-13kD-B;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5;NADH-ubiquinone oxidoreductase 13 kDa-B subunit;NUFM;type I dehydrogenase;ubiquinone reductase;UQOR13
- Extra Details:
- This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16.
- Shipping Conditions:
- Blue Ice

