A3948
ERK5 Rabbit monoclonal antibody

Size
POA
- SKU:
- A3948
- Additional Names:
- BMK1|ERK4|ERK5|PRKM7
- Application:
- ELISA, WB
- Molecular Weight:
- 115kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
- Uniprot:
- Q13164
- Synonyms:
- big MAP kinase 1;BMK-1;BMK1;BMK1 kinase;ERK-5;ERK4;ERK5;Extracellular signal-regulated kinase 5;extracellular-signal-regulated kinase 5;MAP kinase 7;MAPK 7;mitogen-activated protein kinase 7;PRKM7
- Extra Details:
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
- Shipping Conditions:
- Blue Ice



