A3934
PFKFB3 Rabbit monoclonal antibody

Size
POA
- SKU:
- A3934
- Additional Names:
- iPFK-2|IPFK2|PFK2|PFKFB3
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT
- Uniprot:
- Q16875
- Synonyms:
- 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase;6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3;6PF-2-K/Fru-2,6-P2ase 3;6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme;fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase;inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase;iPFK-2;IPFK2;PFK/FBPase 3;PFK2;renal carcinoma antigen NY-REN-56
- Extra Details:
- The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate (F2,6BP), and a fructose-2,6-biphosphatase activity that catalyzes the degradation of F2,6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice








