PFKFB3 Rabbit monoclonal antibody

Size

POA

SKU:: A3934
Additional Names:: iPFK-2|IPFK2|PFK2|PFKFB3
Application:: ELISA, WB, IHC-P
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT
Uniprot:: Q16875
Synonyms:: 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase;6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3;6PF-2-K/Fru-2,6-P2ase 3;6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme;fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase;inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase;iPFK-2;IPFK2;PFK/FBPase 3;PFK2;renal carcinoma antigen NY-REN-56
Extra Details:: The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate (F2,6BP), and a fructose-2,6-biphosphatase activity that catalyzes the degradation of F2,6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice