A3924
IFIT3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3924
- Additional Names:
- Ifi49|IFIT3|P49
- Application:
- ELISA, WB, IHC-P, IP
- Molecular Weight:
- 47 kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADSSERRQRMAELRRLTMEFMQKTLQRRRSPLNS
- Uniprot:
- O14879
- Synonyms:
- CIG-49;cig41;CIG49;GARG-49;glucocorticoid-attenuated response gene 49 protein;Ifi;IFI-60K;Ifi49;IFI60;IFIT-3;IFIT-4;IFIT4;interferon-induced 60 kDa protein;interferon-induced protein with tetratricopeptide repeats 3;interferon-induced protein with tetratricopeptide repeats 4;IRG2;ISG-60;ISG60;P49;P60;retinoic acid-induced gene G protein;RIG-G
- Extra Details:
- Predicted to enable RNA binding activity and identical protein binding activity. Acts upstream of or within cellular response to interferon-beta; response to bacterium; and response to stilbenoid. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Is expressed in alimentary system; eye; face; and nervous system. Orthologous to human IFIT3 (interferon induced protein with tetratricopeptide repeats 3).
- Shipping Conditions:
- Blue Ice







