A3887
TCP1 alpha Rabbit monoclonal antibody
Size
POA
- SKU:
- A3887
- Additional Names:
- CCT-alpha|CCT1|CCTa|D6S230E|TCP-1-alpha|TCP1 alpha
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAEL
- Uniprot:
- P17987
- Synonyms:
- CCT-alpha;CCT1;CCTa;D6S230E;t-complex 1 protein;T-complex protein 1 subunit alpha;T-complex protein 1, alpha subunit;tailless complex polypeptide 1;TCP-1-alpha
- Extra Details:
- The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.
- Shipping Conditions:
- Blue Ice