Glutaminase (GLS) Rabbit polyclonal antibody

Size

£152.00

SKU:: A3885
Additional Names:: AAD20|CASGID|DEE71|EIEE71|GAC|GAM|GDPAG|GLS1|Glutaminase (GLS)|KGA
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 65-73kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Uniprot:: O94925
Synonyms:: AAD20;CASGID;DEE71;EIEE71;GAC;GAM;GDPAG;GLS1;glutaminase C;glutaminase kidney isoform, mitochondrial;glutaminase, phosphate-activated;K-glutaminase;KGA;L-glutamine amidohydrolase
Extra Details:: This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants.