EXTL3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3857
Additional Names:: BOTV|EXTL1L|EXTL3|EXTR1|ISDNA|REGR|RPR
Application:: ELISA, WB, IHC-P
Molecular Weight:: 105kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TTLDEADEAGKRIFGPRVGNELCEVKHVLDLCRIRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKATRGCRLHNCFDYSRCPLTSGFPVYVYDSDQFVFGSYLDPLVKQAFQA
Uniprot:: O43909
Synonyms:: BOTV;epididymis secretory sperm binding protein;exostoses (multiple)-like 3;exostosin tumor-like 3;exostosin-like 3;EXT-related 1;EXT-related protein 1;EXTL1L;EXTR1;glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase;hereditary multiple exostoses gene isolog;ISDNA;Multiple exostosis-like protein 3;putative tumor suppressor protein EXTL3;reg receptor;REGR;RPR
Extra Details:: This gene encodes a single-pass membrane protein which functions as a glycosyltransferase. The encoded protein catalyzes the transfer of N-acetylglucosamine to glycosaminoglycan chains. This reaction is important in heparin and heparan sulfate synthesis. Alternative splicing results in the multiple transcript variants.