A3798
COX6A1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3798
- Additional Names:
- CMTRID|COX6A|COX6A1|COX6AL
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
- Uniprot:
- P12074
- Synonyms:
- CMTRID;COX VIa-L;COX6A;COX6AL;cytochrome c oxidase polypeptide VIa-liver;cytochrome c oxidase subunit 6A1, mitochondrial;cytochrome C oxidase subunit VIa homolog;cytochrome c oxidase subunit VIa polypeptide 1;cytochrome c oxidase subunit VIA-liver
- Extra Details:
- Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented.
- Shipping Conditions:
- Blue Ice








