A3756
ATP6V1E1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A3756
- Additional Names:
- ARCL2C|ATP6E|ATP6E2|ATP6V1E|ATP6V1E1|P31|Vma4
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 31kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
- Uniprot:
- P36543
- Synonyms:
- ARCL2C;ATP6E;ATP6E2;ATP6V1E;ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1;H(+)-transporting two-sector ATPase, 31kDa subunit;H+-transporting ATP synthase chain E, vacuolar;P31;V-ATPase 31 kDa subunit;V-ATPase subunit E 1;V-ATPase, subunit E;V-type proton ATPase subunit E 1;vacuolar proton pump subunit E 1;Vma4
- Extra Details:
- This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome.
- Shipping Conditions:
- Blue Ice