ALDH1B1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3725
Additional Names:: ALDH1B1|ALDH5|ALDHX
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Uniprot:: P30837
Synonyms:: acetaldehyde dehydrogenase 5;aldehyde dehydrogenase 5;Aldehyde dehydrogenase family 1 member B1;aldehyde dehydrogenase X, mitochondrial;ALDH class 2;ALDH5;ALDHX;epididymis secretory sperm binding protein
Extra Details:: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.