A3721
Caspr1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A3721
- Additional Names:
- CASPR|Caspr1|CHN3|CNTNAP|NRXN4|P190
- Application:
- ELISA, WB
- Molecular Weight:
- 190kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EQHFYWGGSQPGIQRCACGLDRSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYGDRNSWNTISFHTGAALRFPP
- Uniprot:
- P78357
- Synonyms:
- CASPR;caspr1;CHN3;CNTNAP;contactin-associated protein 1;neurexin IV;neurexin-4;NRXN4;P190
- Extra Details:
- The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons.
- Shipping Conditions:
- Blue Ice

