KMT1B / SUV39H2 Rabbit monoclonal antibody

Size

POA

SKU:: A3705
Additional Names:: KMT1B|KMT1B / SUV39H2
Application:: ELISA, WB
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Uniprot:: Q9H5I1
Synonyms:: H3-K9-HMTase 2;histone H3-K9 methyltransferase 2;histone methyltransferase SUV39H2;histone-lysine N-methyltransferase SUV39H2;KMT1B;lysine N-methyltransferase 1B;su(var)3-9 homolog 2;suppressor of variegation 3-9 homolog 2
Extra Details:: Enables S-adenosyl-L-methionine binding activity; histone methyltransferase activity (H3-K9 specific); and zinc ion binding activity. Involved in chromatin assembly or disassembly and chromatin remodeling. Acts upstream of or within cellular response to hypoxia and negative regulation of transcription by RNA polymerase II. Located in chromatin.