Plexin A1 Rabbit monoclonal antibody

Size

POA

SKU:: A3698
Additional Names:: DWOPNED|NOV|NOVP|Plexin A1|PLEXIN-A1|PLXN1
Application:: ELISA, WB
Molecular Weight:: 250kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPT
Uniprot:: Q9UIW2
Synonyms:: NOV;NOVP;plexin 1;plexin-A1;PLXN1;semaphorin receptor NOV
Extra Details:: Predicted to enable semaphorin receptor activity. Predicted to be involved in several processes, including generation of neurons; regulation of GTPase activity; and regulation of cell shape. Predicted to act upstream of or within dichotomous subdivision of terminal units involved in salivary gland branching; neuron projection morphogenesis; and regulation of smooth muscle cell migration. Located in cytosol and nucleoplasm.