U1A/SNRPA Rabbit monoclonal antibody

Size

POA

SKU:: A3686
Additional Names:: Mud1|U1-A|U1A|U1A/SNRPA
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 31kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT
Uniprot:: P09012
Synonyms:: Mud1;U1 small nuclear ribonucleoprotein A;U1 small nuclear RNP-specific A;U1 snRNP A;U1 snRNP-specific protein A;U1-A;U1A
Extra Details:: The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation.