A3645
RBBP4 Rabbit monoclonal antibody

Size
POA
- SKU:
- A3645
- Additional Names:
- lin-53|NURF55|RBAP48|RBBP4
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 48kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDS
- Uniprot:
- Q09028
- Synonyms:
- CAF-1 subunit C;CAF-I 48 kDa subunit;CAF-I p48;chromatin assembly factor 1 subunit C;chromatin assembly factor I p48 subunit;chromatin assembly factor/CAF-1 p48 subunit;histone-binding protein RBBP4;lin-53;MSI1 protein homolog;nucleosome-remodeling factor subunit RBAP48;NURF55;RBAP48;RBBP-4;retinoblastoma-binding protein 4;retinoblastoma-binding protein p48
- Extra Details:
- This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice








