ELOVL4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A3639
Additional Names:: ADMD|CT118|ELOVL4|ISQMR|SCA34|STGD2|STGD3
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMG
Uniprot:: Q9GZR5
Synonyms:: 3-keto acyl-CoA synthase ELOVL4;ADMD;cancer/testis antigen 118;CT118;elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4;elongation of very long chain fatty acids protein 4;ELOVL FA elongase 4;ELOVL fatty acid elongase 4;ISQMR;SCA34;STGD2;STGD3;very long chain 3-ketoacyl-CoA synthase 4;very long chain 3-oxoacyl-CoA synthase 4
Extra Details:: This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macular dystrophy (ADMD), also referred to as autosomal dominant atrophic macular degeneration.