[KO Validated] ATG16L1 Rabbit monoclonal antibody

Size

POA

SKU:: A3637
Additional Names:: APG16L|ATG16A|ATG16L|ATG16L1|IBD10|WDR30
Application:: ELISA, WB
Molecular Weight:: 68 kDa/72 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGE
Uniprot:: Q676U5
Synonyms:: APG16-like 1;APG16L;APG16L beta;ATG16 autophagy related 16-like 1;ATG16A;ATG16L;autophagy-related protein 16-1;IBD10;WD repeat domain 30;WDR30
Extra Details:: The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.