A3636
SLC16A2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A3636
- Additional Names:
- AHDS|DXS128|DXS128E|MCT 7|MCT 8|MCT7|MCT8|MRX22|SLC16A2|XPCT
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFG
- Uniprot:
- P36021
- Synonyms:
- AHDS;DXS128;DXS128E;MCT 7;MCT 8;MCT7;MCT8;monocarboxylate transporter 7;monocarboxylate transporter 8;MRX22;Solute carrier family 16 member 2;solute carrier family 16, member 2 (thyroid hormone transporter);X-linked PEST-containing transporter;XPCT
- Extra Details:
- This gene encodes an integral membrane protein that functions as a transporter of thyroid hormone. The encoded protein facilitates the cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues and likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. Mutations in this gene are the cause of Allan-Herndon-Dudley syndrome.
- Shipping Conditions:
- Blue Ice

